Protein Info for PP_3075 in Pseudomonas putida KT2440

Annotation: putative transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 PF13188: PAS_8" amino acids 45 to 88 (44 residues), 25.2 bits, see alignment 4.7e-09 PF08448: PAS_4" amino acids 47 to 101 (55 residues), 25.5 bits, see alignment 5.1e-09 PF00158: Sigma54_activat" amino acids 180 to 346 (167 residues), 217.6 bits, see alignment E=3.6e-68 PF14532: Sigma54_activ_2" amino acids 180 to 351 (172 residues), 74.2 bits, see alignment E=5.2e-24 PF07728: AAA_5" amino acids 202 to 320 (119 residues), 30.1 bits, see alignment E=1.9e-10 PF00004: AAA" amino acids 203 to 322 (120 residues), 22.1 bits, see alignment E=7.4e-08 PF02954: HTH_8" amino acids 440 to 478 (39 residues), 39.1 bits, see alignment 2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3075)

Predicted SEED Role

"sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IC4 at UniProt or InterPro

Protein Sequence (481 amino acids)

>PP_3075 putative transcriptional regulator (Pseudomonas putida KT2440)
MSFQAWPFRGLVPIHDSGCSPMHDSDSLKDYPQVRQLAIRSLFEIIEQSSEGTVIVDRQA
RIVWMNERYARRFGLADAASAIGQPCETVIPGSLMRDVVSNGRPILLDMLDTPNEPLVVM
RLPIHDDQGALIGAIGFALFDELRSLSPLLKRYASMQQELASTRSQLRARQAKYSFAQFV
GSSAPSLEAKRRARRGAGSDSPVLLLGETGTGKELLAHAIHAASARAHRAFVSINSAAIP
ETLLEAEFFGTAPGAFTGADRKGRSGKLQLAEGGTLFLDEIGDMPLALQSKLLRVLQEKE
YEPVGSNQMLRSDVRIIAATSIDLQAAMARGAFRADLYYRLNVLPIDVPPLRQRLEDLPA
LCEAILAELGSQYELEAEAQQLLARHAWPGNIRELRNVLERATLLADQPRLGVADLRAAL
GPLSPLAEAPVRQSYREACEAFERGLIAGALAEQGGKVPEAAAALGLGRSTLYKKMAALG
L