Protein Info for PP_2971 in Pseudomonas putida KT2440

Annotation: transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF05598: DUF772" amino acids 57 to 128 (72 residues), 77.8 bits, see alignment E=7.9e-26 PF01609: DDE_Tnp_1" amino acids 144 to 331 (188 residues), 105.4 bits, see alignment E=5.3e-34 PF13359: DDE_Tnp_4" amino acids 183 to 329 (147 residues), 38.3 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: None (inferred from 84% identity to tmz:Tmz1t_0337)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IM8 at UniProt or InterPro

Protein Sequence (345 amino acids)

>PP_2971 transposase (Pseudomonas putida KT2440)
MKKRTAIKTDLFADEHHRKKIDTLGDPLAQIESYIDFAALAAEVDRVAPRPVSPQGGRPP
YPTETMVRILVLKRLYNLSDEQMEYQLLDRMSYKRFCGLASAVNIPDRTTVWTFENRIGD
AGAKVLFDGVTAQLLRHGFIARGGQIVDATLVPAPKQRNSREENKLVREGAMPANWKPAK
RRQKDTDATWTQKHGKNHFGYKLSVNVDKKYKIIRKFETDTASVHDSKHFDALIDRSNTS
RDVYADRGHTSADREGWLKDHGYRNQIQRKGYRNKPLSECQQRRNHRIAKTRARVEHVFA
SIEQMGGKLIRTIGQGRANFAMTMMAACYNLKRLVYFQKAGIKAF