Protein Info for PP_2968 in Pseudomonas putida KT2440

Annotation: putative nickel/cobalt transporter, high-affinity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 276 to 299 (24 residues), see Phobius details amino acids 307 to 333 (27 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details PF03824: NicO" amino acids 16 to 135 (120 residues), 76.1 bits, see alignment E=3e-25 amino acids 237 to 374 (138 residues), 69.5 bits, see alignment E=3.2e-23 PF13386: DsbD_2" amino acids 266 to 348 (83 residues), 37.1 bits, see alignment E=3.2e-13

Best Hits

KEGG orthology group: K08970, nickel/cobalt exporter (inferred from 100% identity to ppu:PP_2968)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IN1 at UniProt or InterPro

Protein Sequence (377 amino acids)

>PP_2968 putative nickel/cobalt transporter, high-affinity (Pseudomonas putida KT2440)
MSSFAELLQQGASQAWLYFPSAILLGALHGLEPGHSKTMMAAFIVAIRGTVKQAVLLGLA
STLSHTAVVWLVAMAGMYLGQNLNAETTEPYFQLASAAIIITIALWMLWRTWRGEQMWRF
EEGDDLQHDYHHHDEMQRIDTGHGRIELSIFEEGVPPRWRLNILTGHAWSAAEMSLLTTR
PDGLAQQFRFVDRGDYLESVDEIPEPHEFTARLSLGHAGHSHDYDLEFHEHGHGHGHDHA
ELEGLELSLEGYQDAHERAHANDIRKRFSNRNVTTGQIILFGLTGGLIPCPAAITVLLLC
LQVKEVALGAVLVLCFSIGLAITLVTVGAAAAIGARQASNRWPWLGAVARRAPYLSSLLI
IGVGIYVGVHGWIGLNA