Protein Info for PP_2959 in Pseudomonas putida KT2440

Annotation: Alkylhydroperoxidase AhpD domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 TIGR01926: uncharacterized peroxidase-related enzyme" amino acids 6 to 158 (153 residues), 88.6 bits, see alignment E=4.4e-29 PF02627: CMD" amino acids 44 to 108 (65 residues), 43.4 bits, see alignment E=1.4e-15 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 57 to 106 (50 residues), 50.5 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_2713)

Predicted SEED Role

"Alkylhydroperoxidase AhpD domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IP0 at UniProt or InterPro

Protein Sequence (172 amino acids)

>PP_2959 Alkylhydroperoxidase AhpD domain protein (Pseudomonas putida KT2440)
MTRITALSLDQAPTGSRAALEGIQKGLGFIPNAFRTLAHAPVALNGYLGLAQALGKSSLS
AAEREVVALATSEINGCDYCLAAHTFFGGKAGLSDEAVSQARAGTLSAVAALAQQITARR
GQLSDEQIAAAREAGLTDSKIVEVVAQVTLLTLTNYLNNIAATDIDFPPSAN