Protein Info for PP_2927 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF21320: HTH_65" amino acids 26 to 90 (65 residues), 38.3 bits, see alignment E=6.2e-13 PF13489: Methyltransf_23" amino acids 157 to 280 (124 residues), 43.6 bits, see alignment E=1.4e-14 PF00891: Methyltransf_2" amino acids 165 to 277 (113 residues), 34.4 bits, see alignment E=7.3e-12 PF01209: Ubie_methyltran" amino acids 167 to 272 (106 residues), 23.7 bits, see alignment E=1.5e-08 PF05175: MTS" amino acids 168 to 240 (73 residues), 23.5 bits, see alignment E=2e-08 PF13847: Methyltransf_31" amino acids 168 to 282 (115 residues), 58.4 bits, see alignment E=3.5e-19 PF02390: Methyltransf_4" amino acids 172 to 217 (46 residues), 26.9 bits, see alignment 1.6e-09 PF13649: Methyltransf_25" amino acids 172 to 266 (95 residues), 51 bits, see alignment E=9.5e-17 PF08242: Methyltransf_12" amino acids 174 to 267 (94 residues), 47.8 bits, see alignment E=1e-15 PF08241: Methyltransf_11" amino acids 174 to 269 (96 residues), 46.8 bits, see alignment E=1.9e-15

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_2765)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IS2 at UniProt or InterPro

Protein Sequence (348 amino acids)

>PP_2927 conserved protein of unknown function (Pseudomonas putida KT2440)
MDEARLHDFMGKLVGDMGAAATLANVILGDELGLYRAMADSQAVTPEQLAEKTGCHPRLV
REWLNAQAASGYMVHDKGRFVLPEEQAMALALEDSPAYMAGGAAVVAALFHDKDKLVAAM
RGDGGLAWGDHHPCMFSGTERFFRPGYRTFLVADWLPALEGVVAKLQAGAKVADVGCGHG
ASTLVMAQAFPASTFVGYDYHQPSIVTANARAREAGLEGRVSFQQASAKEYPGHDHDLVC
FFDCLHDMGDPVGAARHAYHALKADGTVMLVEPYAEDSLEGNLTPVGRLFYAASTFICTP
NSLSQEVGLGLGAQAGEARLRAVFEEAGFSRFRRATQTPFNLILEARK