Protein Info for PP_2905 in Pseudomonas putida KT2440

Annotation: Cysteine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 TIGR00435: cysteine--tRNA ligase" amino acids 2 to 457 (456 residues), 577.5 bits, see alignment E=1.3e-177 PF01406: tRNA-synt_1e" amino acids 15 to 313 (299 residues), 459.4 bits, see alignment E=1.8e-141 PF09334: tRNA-synt_1g" amino acids 35 to 135 (101 residues), 20.3 bits, see alignment E=6.4e-08 amino acids 246 to 307 (62 residues), 25.7 bits, see alignment E=1.5e-09 PF00133: tRNA-synt_1" amino acids 222 to 304 (83 residues), 25.7 bits, see alignment E=1.5e-09 PF09190: DALR_2" amino acids 340 to 394 (55 residues), 70.3 bits, see alignment 4.8e-23 PF23493: CysS_C" amino acids 412 to 457 (46 residues), 43.6 bits, see alignment 7.5e-15

Best Hits

Swiss-Prot: 100% identical to SYC_PSEPK: Cysteine--tRNA ligase (cysS) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 100% identity to ppu:PP_2905)

MetaCyc: 59% identical to cysteine--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Cysteine--tRNA ligase. [EC: 6.1.1.16]

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IU4 at UniProt or InterPro

Protein Sequence (460 amino acids)

>PP_2905 Cysteine--tRNA ligase (Pseudomonas putida KT2440)
MLTIYNTLSKTKEVFKPLDGNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLRKSGYE
LTYVRNITDIDDKIINRANENGETFDALTARMIDAMHEDERRLNILPPDQEPRATDHIAG
MHAMIQTLIDKGYAYAPGNGDVYYRVGKFVGYGKLSRKRIEDLRIGARIEVDEAKQDPLD
FVLWKGVKPGEPSWESPWGPGRPGWHIECSVMSTCCLGESFDIHGGGSDLEFPHHENEIA
QSEAATGKQYANAWMHCGMIRINGEKMSKSLNNFFTIRDVLEKYHPEVVRYLLVASHYRS
AINYSEDSLRDAKGALERFYHALRGLPRVAAKGGEAFVERFSVAMNDDFGTPEACAVLFD
LVREINRLRDSDVEAAAGLAGRLRELGDVLGVLQLEADDFLRAGAEGKVDAAEVEGLIQA
RLKARADKNWAESDRIRDQLTAMGVVLEDSKGTTTWRLAD