Protein Info for PP_2901 in Pseudomonas putida KT2440

Annotation: Acyl-homoserine lactone acylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 772 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF01804: Penicil_amidase" amino acids 37 to 751 (715 residues), 443.7 bits, see alignment E=1e-136

Best Hits

Swiss-Prot: 100% identical to PVDQ_PSEPK: Acyl-homoserine lactone acylase PvdQ (pvdQ) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K07116, (no description) (inferred from 100% identity to ppu:PP_2901)

MetaCyc: 54% identical to acyl-homoserine lactone deacylase precursor (Pseudomonas aeruginosa)

Predicted SEED Role

"Acyl-homoserine lactone acylase PvdQ (EC 3.5.1.-), quorum-quenching" in subsystem Siderophore Pyoverdine (EC 3.5.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IU8 at UniProt or InterPro

Protein Sequence (772 amino acids)

>PP_2901 Acyl-homoserine lactone acylase (Pseudomonas putida KT2440)
MPVFPFCRPMTCAGLAAALVAFSVGVQAQPAPADASAQIRYTRYGVPHIVAKDERGLGYG
VGYAYAQDNLCLLANEVLTVSGERSRYFGAKGQTLEQRDNLASDLFFTWLNSPAAVDAFL
QAQPASVQALLAGYASGYNRALVERRRQGLPAECGDGEWVRPISSQDLVKLTRRLLAEGG
VGQFVEALAGAQPPTLARAQSSAGFASALARQERFAAERGSNAVAVGAQRSANGRGLLLA
NPHFPWMGGMRFYQMQLTIPGQLDVMGAALPGLPVVNIGFNQHLAWTHTVDTSKHFTLYR
LQLDPKDPTRYVLDGKSLPMARQTIRVAVKGTDGSLSQIERQVYSSQFGPVVQWPGRLDW
DAQAAYSVRDANLENSRVLQQWYQINRADSLAALKGSVEQLQGIPWVNTLAVDQGGRALY
LNQSVVPYVDQQLLDTCSNPQAQGRLVVLDGSRSACQWKVDAQAAQPGIFPARLLPSLER
EDFVQNSNDPAWMANPAQPLTGYSPLVSRNDQPLGMRGRFALQRLQGKARLGVDELQRMV
TDEEVYLASLVLPDLLQWCKGASADVQAVCSSLAAWNGKADLDSGMGLVHFQNLFNALAE
HPESWRVAFNPADPQHTPRGLAVEQAAVSRLVHQAALASLKQVSESGVAGAARWGQVQQA
LDGTPVPGGPQALGVYNAIYSVPHGQGKRLVVSGTSYLQLVSFTDKGPEARGLLAFSQSS
EKASAHASDQTKAFAAKQLALIPFTEAQIKADPEYREVVISERDKGAVVSQP