Protein Info for PP_2892 in Pseudomonas putida KT2440

Annotation: conserved exported protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF17243: POTRA_TamA_1" amino acids 31 to 106 (76 residues), 70.7 bits, see alignment E=1.3e-23 PF07244: POTRA" amino acids 195 to 265 (71 residues), 35.2 bits, see alignment E=2.6e-12 PF01103: Omp85" amino acids 296 to 580 (285 residues), 123.8 bits, see alignment E=1.7e-39

Best Hits

KEGG orthology group: K07278, outer membrane protein (inferred from 100% identity to ppu:PP_2892)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IV7 at UniProt or InterPro

Protein Sequence (583 amino acids)

>PP_2892 conserved exported protein of unknown function (Pseudomonas putida KT2440)
MRRMTYSGRLTWGLVFWVASFAAWGQSELLVKVKPANKALKANVEGYIGTLGDRDEEALL
RFSRGAEEQARKAAQALGYYQAQIDTEVKPASDADHPPKLIISINPGEPIRLRNVTVRIE
GPASEMKAFRVPDSKALRPGEQLNHGHYEDAKRLIQNQASRYGFFSGRFSSQRLAVDPQA
GVADIELVYQSGPRYRLGAVTFGGDTPLDEDLLQRMVSFKPGTPYDSELVAELNNDLQSS
GYFEGVRVDAAPTAAVGEEVPVDVHLETRKPRTMGLGLGFSTDVGPRGKANWTRHWVNPQ
GHSYGWETELSAPRQNVGLWYDIPLDPPLTDKLRFAGGYQNEELAGTDTLSKLLTVGPEW
HSKLPSGWQRVISLKYQREEYRLGDDSGLSNLLMPGVSFSFLRSDNRIDPHNGYRLQFDV
QGAKEGLVSDTNLLHGNVLLKGLTTLGHNHRFLGRVQFGGSATNGFKNNIPPSLRFFAGG
DQSVRGYDYQTLSPKNSDGDRIGGRYLVAGSVEYQYSLTEKWRVATFVDQGNSFNDLELP
SLKTGVGFGVRWVSPVGPLRLDLAKALDDEGGIRLHFSMGPEL