Protein Info for PP_2888 in Pseudomonas putida KT2440

Annotation: putative ECF sigma factor PrtI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 10 to 158 (149 residues), 66.8 bits, see alignment E=9e-23 PF04542: Sigma70_r2" amino acids 10 to 74 (65 residues), 37.7 bits, see alignment E=3.6e-13 PF22029: PhyR_sigma2" amino acids 12 to 62 (51 residues), 47.4 bits, see alignment E=4.1e-16 PF07638: Sigma70_ECF" amino acids 37 to 157 (121 residues), 24 bits, see alignment E=8e-09 PF08281: Sigma70_r4_2" amino acids 108 to 156 (49 residues), 57.1 bits, see alignment E=2.8e-19 PF04545: Sigma70_r4" amino acids 109 to 158 (50 residues), 42.6 bits, see alignment E=8.8e-15

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 99% identity to ppf:Pput_2802)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IW1 at UniProt or InterPro

Protein Sequence (173 amino acids)

>PP_2888 putative ECF sigma factor PrtI (Pseudomonas putida KT2440)
MHDLDDHQWRELLARLRRFAVWLTREPGSADDLVQATVERALSRRDQQRDADALRAWLFT
ILYRQFLDGKRRERLHARWLSWFGRNEHDDEPVGDNLETIVLAQADLQAFARLTAEQRAL
LLLVSIEGLSYKEAAQALGIPIGTVMSRLSRARNALRELTEGNPQPPALRRLK