Protein Info for PP_2866 in Pseudomonas putida KT2440

Annotation: FMN-dependent NADH-azoreductase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF02525: Flavodoxin_2" amino acids 1 to 197 (197 residues), 182 bits, see alignment E=1.2e-57 PF03358: FMN_red" amino acids 1 to 147 (147 residues), 52.2 bits, see alignment E=5.2e-18

Best Hits

Swiss-Prot: 100% identical to AZOR1_PSEPK: FMN-dependent NADH-azoreductase 1 (azoR1) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 98% identity to ppg:PputGB1_2915)

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IY3 at UniProt or InterPro

Protein Sequence (203 amino acids)

>PP_2866 FMN-dependent NADH-azoreductase 1 (Pseudomonas putida KT2440)
MKLLHIDSSILGDNSASRQLSREVVEAWKAADPSVEVVYRDLAADAIAHFSAATLVAAGT
PEDVRDAAQAFEAKLSAETLEEFLAADAVVIGAPMYNFTVPTQLKAWIDRVAVAGKTFRY
TEAGPQGLCGNKKVVLVSTAGGLHAGQPTGAGHEDFLKVFLGFIGITDLEIVRAHGLAYG
PEQRSQAIDAAQAQIASELFAAA