Protein Info for PP_2859 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13521: AAA_28
  • amino acids 11 to 166 (156 residues), 113.2 bits, E=7.7e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2859)

Predicted SEED Role

"Ribosylnicotinamide kinase (EC 2.7.1.22)" in subsystem NAD and NADP cofactor biosynthesis global or PnuC-like transporters (EC 2.7.1.22)

MetaCyc Pathways

• NAD salvage pathway IV (from nicotinamide riboside) (1/2 steps found)
• superpathway of NAD biosynthesis in eukaryotes (5/14 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.22

Sequence Analysis Tools

See Q88IZ0 at UniProt or InterPro

Protein Sequence (189 amino acids)

>PP_2859 conserved protein of unknown function (Pseudomonas putida KT2440)
MSAPQAMKVLVLCGPESSGKSWLSGVIQAHFGGLVVGEYVRHFIDQQCRDTCYADIPAIA
RGQLAWEDRAREQAPPLLILDTHLLSNMLWSHALFGDCPTWLEEALLARRYDLHLLLSPQ
GVDWIADGQRCQPDLSDRQRFFDDSQAWLRRHNQPHQILDGNWPQRQLLALQSVAKLLNS
DAPSCPTEC