Protein Info for PP_2848 in Pseudomonas putida KT2440

Annotation: urease accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01730: UreF" amino acids 38 to 181 (144 residues), 110.8 bits, see alignment E=3.9e-36

Best Hits

Swiss-Prot: 100% identical to UREF_PSEPK: Urease accessory protein UreF (ureF) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03188, urease accessory protein (inferred from 100% identity to ppu:PP_2848)

Predicted SEED Role

"Urease accessory protein UreF" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J01 at UniProt or InterPro

Protein Sequence (224 amino acids)

>PP_2848 urease accessory protein (Pseudomonas putida KT2440)
MNSDLALLRLLQLASPGLPVGGFTYSQGLEWAVEAGWVRGVDSFAGWQREQVHDTLACLD
WPVLARLYHACQAKDAEAFGHWSRFLLANRETAELRLEEQQRGAALARLLDGWQLGQAPA
WRASLELTQLGGMAWLAAHWAIPLRQLALGHGFAWLEGAVMAGVKLVPFGQQAAQTLLRD
LGADLPAALDQALALGDDQLGGGLPLLAIASSRHETQYTRLFRS