Protein Info for PP_2842 in Pseudomonas putida KT2440

Annotation: urease accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF01774: UreD" amino acids 58 to 247 (190 residues), 176.9 bits, see alignment E=2.9e-56

Best Hits

Swiss-Prot: 100% identical to URED_PSEPK: Urease accessory protein UreD (ureD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03190, urease accessory protein (inferred from 100% identity to ppu:PP_2842)

Predicted SEED Role

"Urease accessory protein UreD" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J07 at UniProt or InterPro

Protein Sequence (277 amino acids)

>PP_2842 urease accessory protein (Pseudomonas putida KT2440)
MSLAEQIEQQQDDAGWSAHLQLRFVQRDGVTRLGAWKHFGPLLVQRPFYPEGAPCHVYVL
HPPGGIVAGDRLELDIHLEPGSHALLTMPGASKFYRSIGPTARLAQRFHLAAGSTLEWLP
QDSIFFSGARASLASRFTLEPGARLLAWETLCLGRPVMHERFDHGALDSLLHIELPDEVG
LHERLRLEGGHLGKLGGHPLLATFCAAPANQAVLEQVRPLLDELGNPAGATLLGSLLVIR
VLDHDNQHLQRTLQRLWHVLRPAILGLPACPPRIWAT