Protein Info for PP_2838 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 PF21315: FAN1_HTH" amino acids 10 to 91 (82 residues), 126.6 bits, see alignment E=4.3e-41 PF18081: FANC_SAP" amino acids 95 to 145 (51 residues), 50.2 bits, see alignment 3.6e-17 PF08774: VRR_NUC" amino acids 433 to 545 (113 residues), 142 bits, see alignment E=1.3e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2838)

Predicted SEED Role

"Hypothetical protein, restriction endonuclease-like VRR-NUC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J11 at UniProt or InterPro

Protein Sequence (549 amino acids)

>PP_2838 conserved protein of unknown function (Pseudomonas putida KT2440)
MIAHSVDDPFYYLHNFRQVVLWVEQRYQDLLDDQELAFIRAFSQLQAPAQALMVRMVMRK
GELFRSDRLDYAEIGDTALALQPLLALGWVREPEQLDLEQLFALLRKEELARCFARQLNR
PRAAKHELLAQLQPLALAARSLVEWFPDSDVRILQWCLQPLCDRIRLLFFGNLYQDWSDF
VLADLGLLRYEQVPFSPDSRALQQRDDVDLAMALHHCAERLEQGGDPLPILATLQGLHSS
NPWLARRHARLQFAVGQQCERLGEWDLATAVYAQCNHPQARIRQVRVLERSEQWHQAHAR
ALQLAAAPANALEEQALQRMLPRLARKLGGPPQRRQRTTPLELIELELPRGDAALGVEEA
VRQHLMQEGGQAHYVENTLFNSLFGLLCWEAIFAPVPGAFFNPFQAAPQDLHDSDFQQRR
SALFERCLGRLDEGSHRQAILDCYVAKQGLQSPFVSWSMLSEELLEQALACLPAAALKQC
FLRLLQDIRSNRAGMPDLIQFWPEQGRYRMVEVKGPGDRLQDNQLRWLAFCRQHGLPVAV
CHVRWSETP