Protein Info for PP_2837 in Pseudomonas putida KT2440

Annotation: putative uronate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 77 to 104 (28 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 269 to 293 (25 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 357 (343 residues), 176.1 bits, see alignment E=5e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2837)

Predicted SEED Role

"D-galactarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J12 at UniProt or InterPro

Protein Sequence (436 amino acids)

>PP_2837 putative uronate transporter (Pseudomonas putida KT2440)
MNPMKKYQRITVVFLLLIGIVNYLDRSALSIANTSIQKDMMISPSQMGILLSAFSIAYAF
AQLPMGMIIDRLGSKIALGASLLGWSVAQAAFGMVNSFAGFMGLRVLLGIGEAPMFPSAA
KALSEWFDANERGTPTGVVWSSTCLGPCLAPPLLTLFMVNFGWRGMFIITGVIGVVLALC
WLTFYKSKARFLAELAAEGKPLPSERQAAAATAPKASYFAGWLDLFKHRSTWGAVLGFMG
VIYMLWLHLTWLPGYFEREHGLDLYKTAWVVSLAYGFGAAGTIVAGRFCDWLVRRGMSVL
GSRKFSVITGLVLAALFTLPLSFVTGLTGCIMLLCLALFSINMASATAWMIVNTIVDSQR
VASFGSIQNFGGYIAGSVAPIVTGFSIQYSGSFTTAFMISAVVALCSAVAYFLLLQAPIG
SAKVEAGGMAGATEQA