Protein Info for PP_2832 in Pseudomonas putida KT2440

Annotation: galactose-binding protein regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 198 to 214 (17 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details PF00126: HTH_1" amino acids 23 to 81 (59 residues), 58.2 bits, see alignment E=6.3e-20 PF03466: LysR_substrate" amino acids 107 to 314 (208 residues), 109.8 bits, see alignment E=1.3e-35

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_2857)

Predicted SEED Role

"Regulatory protein, LysR:LysR, substrate-binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J17 at UniProt or InterPro

Protein Sequence (315 amino acids)

>PP_2832 galactose-binding protein regulator (Pseudomonas putida KT2440)
MSRLPPDKAQAPASLGALKISSRQITLLNALGEFGNLRRAAAAMHTTQPAASLLLQQLEE
RLGVRLFERLPRGMQATLYGEVMIRYAQNALHEFDHAQAQIAELARGALGLVRVGSVMGP
VPGVLTKAVLAYKRDQPKVRISLEVGTSDTLLPALLRGDFDMVVGRLPDQSDSQELNIEL
FDGGEQMRIIARAGHPLATATGLQLADLVSLTWILHPIGSPMRRRVESALQAGGMVQSLD
IVETASILATTAMLEASEMIAVVPNDVAQHYARYGMVAVLPVELPLAMANLGVLTLRSRP
NSVALDTLLRYLRAQ