Protein Info for PP_2831 in Pseudomonas putida KT2440

Annotation: L-fuconate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF02746: MR_MLE_N" amino acids 9 to 111 (103 residues), 36 bits, see alignment E=7.4e-13 PF13378: MR_MLE_C" amino acids 176 to 392 (217 residues), 209 bits, see alignment E=7.8e-66

Best Hits

Swiss-Prot: 61% identical to ENOF1_HUMAN: Mitochondrial enolase superfamily member 1 (ENOSF1) from Homo sapiens

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_2858)

MetaCyc: 56% identical to L-fuconate dehydratase monomer (Xanthomonas campestris pv. campestris)
L-fuconate dehydratase. [EC: 4.2.1.68]

Predicted SEED Role

"L-fuconate dehydratase (EC 4.2.1.68)" in subsystem L-fucose utilization temp (EC 4.2.1.68)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J18 at UniProt or InterPro

Protein Sequence (411 amino acids)

>PP_2831 L-fuconate dehydratase (Pseudomonas putida KT2440)
MNSAPDYSAAYVVLHTDAAALEGHGLTFTIGRGNEICAAAVQSLAPLIVGLTLEEISADM
GAFWHRFTVSDSQLRWLGPEKGVIHLATAAIINAVWDLWAKHEGKPVWKLLADMTPEQLV
RCLDFSYVTDVLTPEEAIALLRRQAPGKAEREAHMLREGYPGYTTAPGWLGYSEEKMRKL
AREAVADGWTHIKQKIGADLEEDIRRASILRDEIGWERTLMMDANQVWGVEESVANMRRL
AAFEPLWIEEPTSPDDILGHATIRQRIAPIGVATGEHCHNRVMFKQMFQAGALDFCQLDA
ARLGGLNEVLIVLLMAAKYDVPVCPHGGGVGLCEYVQNIALFDYIAVSASLHNRVLEYVD
HLHEHFIDPVVIHRGRYMPPQRPGYSIEMHAETLERYQYPNGAVWLDINRS