Protein Info for PP_2819 in Pseudomonas putida KT2440

Annotation: Outer membrane protein OprJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 12 to 463 (452 residues), 397.6 bits, see alignment E=3.9e-123 PF02321: OEP" amino acids 63 to 252 (190 residues), 65.2 bits, see alignment E=3.5e-22 amino acids 280 to 461 (182 residues), 112.1 bits, see alignment E=1.5e-36

Best Hits

Swiss-Prot: 75% identical to OPRJ_PSEAE: Outer membrane protein OprJ (oprJ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K08721, multidrug resistance outer membrane protein OprJ (inferred from 100% identity to ppu:PP_2819)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein, NodT family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J30 at UniProt or InterPro

Protein Sequence (468 amino acids)

>PP_2819 Outer membrane protein OprJ (Pseudomonas putida KT2440)
MMIMVNRVLPIVLALTLAGCSLTPTYQRPEAPVAAEWGDAAGHTGHSVEQLDWQAFIVDP
VLRQLVGTALDNNRSLRQTLLDIEQARAQYRIQRADRVPGLNASASGNRQHLPAALSSDG
REGVSSTYQVGLSLPEYEVDLFGRVKSLSDAALEQYLATEEVGRAARIALIAEVSQAYLA
LDGAERRQALTRQTLASREDSLALVGQRRAAGTATALDHQEALGLVEQSRAELEVTVRQQ
RQAYNALVLLLGSAEAAKAMPAERPDEPMVLNDIVPGAPSALIERRPDILAAEHRLRARN
ADIGAARAAFFPRISLTGSFGTASAQMSGLFDGGSRSWAFMPQLSLPLFDAGRNRAGLSL
AEARKDSAVAAYEGAIQVAFREVADALAATDTLRREQAARRALADTSRETLTLAKARYEG
GVDNHLRYLDAQRNSYVNEAAFIEASTQRQLALVNLFRALGGGWPSKG