Protein Info for PP_2817 in Pseudomonas putida KT2440

Annotation: Multidrug efflux RND membrane fusion protein MexC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 38 to 369 (332 residues), 273.4 bits, see alignment E=1.1e-85 PF16576: HlyD_D23" amino acids 60 to 288 (229 residues), 44.5 bits, see alignment E=1.7e-15 PF13533: Biotin_lipoyl_2" amino acids 63 to 111 (49 residues), 33.7 bits, see alignment 3.7e-12 PF13437: HlyD_3" amino acids 66 to 138 (73 residues), 22.9 bits, see alignment E=1.8e-08

Best Hits

Swiss-Prot: 47% identical to ACRE_ECOLI: Multidrug export protein AcrE (acrE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2817)

MetaCyc: 47% identical to multidrug efflux pump membrane fusion lipoprotein AcrE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-367

Predicted SEED Role

"Multidrug efflux RND membrane fusion protein MexC" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J32 at UniProt or InterPro

Protein Sequence (378 amino acids)

>PP_2817 Multidrug efflux RND membrane fusion protein MexC (Pseudomonas putida KT2440)
MMGKTGSIRVGALAMAIALAGCEPAAEQDGAANASYPVEIVTLAPEQVALAAELPGRVEP
MRVAEVRARVPGIVLHKRFEEGADVKAGDVLFQIDPAPFKAALARAEADLARAQAVQQEA
QARVKRYEPLVKIEAVSQQDFDSATAELRSAGAAVRSAQADVQAARLNLGYATVTAPISG
RIGRALATEGALVGQGEATLMARIQQLDPIYIDFTQSAADALRLRQALKDGALSADSQRL
TAQVEGTDFQRSGELMFTDVSVDRGTGQVILRGRFDNADGTLLPGMYVRVRTPQGTDNHA
ILVPQRAVQRGSDGQARVLVATNGIAEARAVRTGVMQGSRWQITEGLEPGDQVIVGSPAG
LAPGMPVAPAQKQTAAAQ