Protein Info for PP_2812 in Pseudomonas putida KT2440

Annotation: putative Transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 804 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 293 to 317 (25 residues), see Phobius details amino acids 337 to 360 (24 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details amino acids 424 to 442 (19 residues), see Phobius details amino acids 637 to 653 (17 residues), see Phobius details amino acids 658 to 676 (19 residues), see Phobius details amino acids 682 to 707 (26 residues), see Phobius details amino acids 727 to 751 (25 residues), see Phobius details amino acids 763 to 786 (24 residues), see Phobius details PF03176: MMPL" amino acids 171 to 422 (252 residues), 27.6 bits, see alignment E=2.2e-10 amino acids 588 to 794 (207 residues), 59.3 bits, see alignment E=4.8e-20 PF00873: ACR_tran" amino acids 594 to 786 (193 residues), 32.4 bits, see alignment E=3.5e-12

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 100% identity to ppu:PP_2812)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J37 at UniProt or InterPro

Protein Sequence (804 amino acids)

>PP_2812 putative Transporter (Pseudomonas putida KT2440)
MNGSVKLSEAPARGLLSRVEGVLFGHRRLVLASLAVFTLIMGWFAVQLRMDAGFEKQLPL
GHEYIKTFEAYRNDLLGANRLTIVVKARQGDIWSAPGLKRLYDVTQAVTFLPGVSRSSVR
SLWTPNAFVNEITEEGFRADPLVPGTVSPDHLDDQIIATIANSTAQGGFIGTLVSRDQSS
AMITVELNEYGTNGAHLDYVAFNHRLEKEIRQQFEDGEFEVQIIGFAKQIGDIADGASAV
LEFCLLALLLTAGAVYWYCHSLRFTLLALVCSLASLVWQFGSLRLLGYGLDPLAVLVPFL
VFAIGVSHGVQQINFIVREIAIGKSAEEAARSSFTGLLIPGTLALVTALVSFVTLLLIPI
PMVREVAITASLGVAYKIITNLLMLPLLASMLRVDDRYAAAQEVSRQRRTRWLRGLARLA
EWRNAQWVLGVALVVFLVAIWQSHDRVVGSLQAGAPELREDSRFNRDAVSIATSYDIGLD
WLSVVFEANQGASGEGEAAACEDVAAGQYQDRFVWAMQGVPGVLSVASFSSNMRQFNEGY
NEGNPKMAAVPIDPMNYAALATEVARTPGLVRTDCSMSAVHLYLADHKATTINRVVDAAK
AFRSDYPQPGLSIRLASGNAGVLAAINEEVEKSETPMLLYVYAAIALLVFAVYRDLRAVL
VCCLPLTIGTFIGYWFMKELQIGLTIATLPVMVLAVGIGVDYAFYIYNRLQLHLAHGQSI
TKAVEHALLEVGVATIFTAITLAVGVATWAFSELKFQADMGKLLAFMFIVNMVMAMTVLP
AFAVWLERVFPRKRPVRMIGALVH