Protein Info for PP_2800 in Pseudomonas putida KT2440

Annotation: putative Diaminobutyrate-2-oxoglutarate transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 45% identical to ECTB_WOLSU: Diaminobutyrate--2-oxoglutarate transaminase (ectB) from Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)

KEGG orthology group: K00836, diaminobutyrate-2-oxoglutarate transaminase [EC: 2.6.1.76] (inferred from 100% identity to ppu:PP_2800)

Predicted SEED Role

"Diaminobutyrate-pyruvate aminotransferase (EC 2.6.1.46)" in subsystem Ectoine biosynthesis and regulation (EC 2.6.1.46)

MetaCyc Pathways

ectoine degradation (3/4 steps found)
norspermidine biosynthesis (4/6 steps found)
ectoine biosynthesis (3/5 steps found)
superpathway of polyamine biosynthesis III (5/8 steps found)
pyoverdine I biosynthesis (7/11 steps found)
rhizobactin 1021 biosynthesis (1/7 steps found)
baumannoferrin biosynthesis (1/11 steps found)

KEGG Metabolic Maps

Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.76

Use Curated BLAST to search for 2.6.1.46 or 2.6.1.76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J49 at UniProt or InterPro

Protein Sequence (417 amino acids)

>PP_2800 putative Diaminobutyrate-2-oxoglutarate transaminase (Pseudomonas putida KT2440)
MNKIETFERLESNVRMYCRDLPLVFDTAQGSKIRGEDGREYLDFFAGAGALNYGHNDPRM
RDALIAYLSANGVTHALDLHTTTKRQFLESIERDLLKPRGWDYKVQFTGPTGADAVEAAL
KLARKATGRTKVVSFYGAYHGMTAGALAVTGNRTRRGPGLSNDVVFVPYEDSPYGEFDSM
GFLERLANDQGSGSELPAAVIVESVQIQAGVYPASNLWLQRLRQWTRDHGVVLICDEIQA
GCGRTGDFFGFERSGIVPDLITCAKSIGGFGLPMAIVLIRAGLDVWQPGDHIGTFRGNQL
AFLTAQIALGYWRDEQFLKLLTDNSAAMTRAVAGFAEIPGVASARSRGMIAGIDFGRGNV
ALAKDAQQRVLQAGVLVDRCGPNGEIIKLMPPVNTPTDQLEQGLNAFGEAVAAALRQ