Protein Info for PP_2790 in Pseudomonas putida KT2440

Annotation: Sigma-54 dependent sensory box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 TIGR02329: propionate catabolism operon regulatory protein PrpR" amino acids 22 to 647 (626 residues), 508.4 bits, see alignment E=2.3e-156 PF06506: PrpR_N" amino acids 37 to 200 (164 residues), 155.8 bits, see alignment E=4.1e-49 TIGR00229: PAS domain S-box protein" amino acids 204 to 313 (110 residues), 27.5 bits, see alignment E=2.9e-10 PF00989: PAS" amino acids 206 to 304 (99 residues), 27.9 bits, see alignment E=1e-09 PF13188: PAS_8" amino acids 207 to 259 (53 residues), 21.2 bits, see alignment 1e-07 PF08448: PAS_4" amino acids 211 to 307 (97 residues), 32.7 bits, see alignment E=3.7e-11 PF00158: Sigma54_activat" amino acids 333 to 499 (167 residues), 230.7 bits, see alignment E=4.1e-72 PF14532: Sigma54_activ_2" amino acids 334 to 504 (171 residues), 55.5 bits, see alignment E=3.9e-18 PF25601: AAA_lid_14" amino acids 505 to 571 (67 residues), 52.3 bits, see alignment E=2.1e-17 PF02954: HTH_8" amino acids 617 to 647 (31 residues), 43.4 bits, see alignment (E = 1.2e-14)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2790)

Predicted SEED Role

"Propionate catabolism operon regulatory protein PrpR" in subsystem Methylcitrate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J59 at UniProt or InterPro

Protein Sequence (650 amino acids)

>PP_2790 Sigma-54 dependent sensory box protein (Pseudomonas putida KT2440)
MDALASQVVVLISHLQRPQQRSRLAHVVAGLTTDYPDTRIEVLDTSVAEALQTARELEQA
GKVDVFVCAGATAAYLRKHLTRPVLAMRVGSGDLLRALGQARERSSQVAVLSYNHVNHDL
QAMAALFTVQVHQAAYTSLEEARQAVEQAAQLGCRSIIGSSTVVELAEQAGLHGVLSLSE
DTARKALEEALGILDTQRVEIAKRRHLNAVLRHIPAGVAAVDNQGVVQSLNPALAQLLDL
PVSAALGRPLQQLCPELDLQQALQEGTGEENRVMRLGSHAVVSNLLPILENGERTGLVLT
CQDITVVQRADQRIRSTRRPGAFTARYRLDQLNGNSKANREMLQLAKRFATSHSTILITG
ESGTGKELLAQGIHNESPRRQGPFVAINCAAFPESLLESELFGYEEGAFSGSRKGGKPGL
FEAAHRGTLFLDEIGDMPVSLQTRLLRVLQEREVLRLGSTEPIAIDVRIIAATHKDLRSA
MDDGDFRTDLYFRLNILRLQTTPLRERPEDIALICRGISQRLLVQGQPPGAADIPAALLP
YLERYAWPGNVRELENVIERAMLSARELLEEHRVNEQYLARVLPELCEGPPPSPARKKSS
GETDLHTIGKVAQLRHVKETLESCRGNLDEAARRLGISRTTLWRRLRSAN