Protein Info for PP_2781 in Pseudomonas putida KT2440

Annotation: putative beta-ketoacyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00109: ketoacyl-synt" amino acids 3 to 260 (258 residues), 76 bits, see alignment E=1.8e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2781)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASII (EC 2.3.1.179)" (EC 2.3.1.179)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.179

Use Curated BLAST to search for 2.3.1.179

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J68 at UniProt or InterPro

Protein Sequence (403 amino acids)

>PP_2781 putative beta-ketoacyl synthase (Pseudomonas putida KT2440)
MKQAVAIAGAGCVLPSGWGVESFWAAATEGRSAITALNARRFSSERVVAFGQIQDQDHQR
SRQDLAQNLQRYCTPAVIWGVSAVRQALEEAGLADEQPDVRFGLYCCQGGYTHPSLESYA
ELLHGCRQDGVADMAAFAKRILQDRAQDPFLVLKGLSNCLLGVTSLALKLVGECNAYMQG
VAGNLAALREATAALQAGRIDAAIVVGAGSELDALALSGLVQAGVISANGSNTLLPFDLR
GTGGIAGEGAAALVLRRREDLSAGPQACLADMTAHASLGRLSLPDSPTDVLVCSGTGDAH
KDRVLCQTLALARASHITSGLAINGILSAAPSLVDLMLARCALQAQSVPPIAGLQQPVAN
LPFIQGAPHAASLAHCLVLNRDDNGFSAAYQVHYSAKVTQDCR