Protein Info for PP_2768 in Pseudomonas putida KT2440

Annotation: putative Branched-chain amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 279 (271 residues), 106.5 bits, see alignment E=7.2e-35

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to ppf:Pput_2986)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J81 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PP_2768 putative Branched-chain amino acid ABC transporter, permease protein (Pseudomonas putida KT2440)
MAFFFEVLIGGLLAGVMYSLVAIGFVLIYKASGVFNFAQGAMVLFAALTFVSLLERGVPF
WLSFLVTLATMIALALLIERAVLRPLVGRSPITLFMATLGLAYIIEGAAQALWGAQVHGL
ELAISDAPLELGGLLLSQFDLFAAATAAALVVLLSLLFNRTRIGLALRAVADDPRAAMSV
GIRLPRVWAVVWAVAGFVGLVAGLLWGARLGVQFSLSLVVLKALPVLIIGGFTSISGAIV
GGLIIGASEKLAEVYFGPLIGGGIENWFPYVLALLFLLVRPAGLFGERAIERV