Protein Info for PP_2762 in Pseudomonas putida KT2440

Annotation: acyl-CoA dehydrogenase/oxidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 236 to 254 (19 residues), see Phobius details PF02771: Acyl-CoA_dh_N" amino acids 35 to 111 (77 residues), 24.7 bits, see alignment E=3.9e-09 PF02770: Acyl-CoA_dh_M" amino acids 137 to 216 (80 residues), 39.4 bits, see alignment E=8.6e-14 PF08028: Acyl-CoA_dh_2" amino acids 241 to 380 (140 residues), 53.6 bits, see alignment E=4.6e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2762)

Predicted SEED Role

"Acyl-CoA dehydrogenase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J87 at UniProt or InterPro

Protein Sequence (412 amino acids)

>PP_2762 acyl-CoA dehydrogenase/oxidase family protein (Pseudomonas putida KT2440)
MTAQAPLPHLSTGTHYESLAARFRPIFTRIAESSVARERDRTLPHEPIQWLKDAGFGAVR
VPVEQGGAGASLPQLFQLLIELAEADSNVPQALRGHFAFVEDRLNAHASTPQDVWFKRFV
DGDLVGCAWTEVGAVKIGDVSTRVSRRGDQWVVNGTKYYSTGSLFSDWIDLFARRDDTGG
DVIAAIRTRQPGITQSDDWDGFGQRTTGSGTSVFENAVVEEENIIDFATRFKYQTAFYQL
VLLAVIVGSGRAAVRDFSQETRKRTRVFSHGNGAAVSEDPQVLQVIGKASGLIYAAEAGT
LRASEAAQQAYLARFGNDENAERKANIAAELESAQAQVAAIEAVLRATSDLFNTLGASGT
STTKQLDRHWRNARTAASHNPVIYKERIIGDWHVNGSEPPYVWQIGGGAKQS