Protein Info for PP_2761 in Pseudomonas putida KT2440

Annotation: putative Ribose ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 118 to 142 (25 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 54 to 315 (262 residues), 91.6 bits, see alignment E=2.4e-30

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to ppu:PP_2761)

Predicted SEED Role

"Putative transmembrane sugar transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J88 at UniProt or InterPro

Protein Sequence (328 amino acids)

>PP_2761 putative Ribose ABC transporter, permease protein (Pseudomonas putida KT2440)
MSDSLSAPQPAGLTGLSGRALLRLVMPTLFAAVLLFFALKAPGFLTVGNLSSLLLNNFVL
LAIVAIGMTYAIAAGGIDLSVGTALDFSALTFVLLLNAGFGLYVAIPGGLLAGSLAGLFN
AGLIAGLRISPFLATLGTLFIGSSVQKLLSEGGQPIYLEAQVRSGLATERMLGVPLPLLL
VALLALVYGVVLARGRLGREIIVLGSQPLVARYSGLAQRRIAALVFIASAFASALAGILL
PATVNAYAPMSGNAFLMNAIGAVFIGATLSLHNRVNVPGTLLGVLFLNVTANGLLLIGWN
FFWQQVATGVLILSVLLFSFASRRLGAG