Protein Info for PP_2750 in Pseudomonas putida KT2440

Annotation: putative Branched-chain amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 24 to 42 (19 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 265 to 292 (28 residues), see Phobius details PF02653: BPD_transp_2" amino acids 50 to 328 (279 residues), 118.1 bits, see alignment E=2e-38

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to ppu:PP_2750)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88J99 at UniProt or InterPro

Protein Sequence (354 amino acids)

>PP_2750 putative Branched-chain amino acid ABC transporter, permease protein (Pseudomonas putida KT2440)
MTATVSRLGAGFDEAPLTLVRRRWPVGLPLLLLVAFVGLPWLGNDYWLNAILIPFLVLSL
AGLGLNVLTGYTGQTSVGAAGFMAVGAFATYGLLLRVPGLPLPLALIGGGLIAGLVGLLF
GIPSSRIKGFYLMVTTLAAQFFLEWVFAKFPWFYNHASSGTISAPRLELFSHSLASPVGR
YLLTLSCVVLLTWVAVNLVRSQVGRNWMAIRDMDTAASVIGIPVERYKRLAFAVSSFYLG
IAGALWAFAYLGTSSAGSFDINRSFQILFIIIIGGMGSIAGNFIGAAFISLTPILLSHAG
QWLFGGNVDAGQLQNLQKILFGCLIIWFLIKEPEGLVRLLGDLRERIRVWPLRF