Protein Info for PP_2734 in Pseudomonas putida KT2440

Annotation: Cyclopropane-fatty-acyl-phospholipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF02353: CMAS" amino acids 108 to 378 (271 residues), 288.5 bits, see alignment E=1.3e-89 PF13489: Methyltransf_23" amino acids 156 to 277 (122 residues), 38.5 bits, see alignment E=2.4e-13 PF13649: Methyltransf_25" amino acids 172 to 265 (94 residues), 43.6 bits, see alignment E=1e-14 PF08241: Methyltransf_11" amino acids 172 to 268 (97 residues), 33.8 bits, see alignment E=1.1e-11 PF08242: Methyltransf_12" amino acids 172 to 266 (95 residues), 35.7 bits, see alignment E=2.9e-12

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 100% identity to ppu:PP_2734)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79), plant type" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JB5 at UniProt or InterPro

Protein Sequence (395 amino acids)

>PP_2734 Cyclopropane-fatty-acyl-phospholipid synthase (Pseudomonas putida KT2440)
MLAQLSKLRHGHLRLLSHGQQWSFGDADSPLQAEVEILDDATWSLIAGNGSIGAGEAYIH
GYWRSPDLALVTRLFVANLEVLDALEGGLARLGRPALRLLHRLNRNDKRGARRNILAHYD
LGNALFERLLDPTMMYSAAQFEHPGQTLEQAQLHKLERICQKLELSPDDHLLEIGSGWGS
LAIHAATRYGCRVTTTTLSEAQYSHTLERVKALGLGQRVQVLREDYRDLQGTFDKLVSIE
MIEAVGHRYLPVYFRQCASLLKPEGLMLLQAITIRDQRYAQAQRSVDFIQRYIFPGGALP
SLSVLLDTASRHTGLNLVHMEDFGLDYAHTLRHWRENLRQARTALTDLGYDDMFQRLWEF
YLCYCQGGFEERAIGVAHLLWAAPQARRAPLPGGA