Protein Info for PP_2723 in Pseudomonas putida KT2440

Annotation: Uncharacterized oxidoreductase YhdF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF00106: adh_short" amino acids 43 to 230 (188 residues), 178.8 bits, see alignment E=1.3e-56 PF08659: KR" amino acids 46 to 223 (178 residues), 37.3 bits, see alignment E=4.1e-13 PF13561: adh_short_C2" amino acids 49 to 281 (233 residues), 205.3 bits, see alignment E=1.7e-64

Best Hits

Swiss-Prot: 50% identical to YHDF_BACSU: Uncharacterized oxidoreductase YhdF (yhdF) from Bacillus subtilis (strain 168)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 99% identity to ppf:Pput_3031)

MetaCyc: 48% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JC6 at UniProt or InterPro

Protein Sequence (285 amino acids)

>PP_2723 Uncharacterized oxidoreductase YhdF (Pseudomonas putida KT2440)
MSDYPTPPFPSQPQSVPGSQRKMDPYPDCGEQSYTGNNRLAGKIALITGADSGIGRAVAI
AYAREGADVAIAYLNEHDDAQETARWVKAAGRQCLLLPGDLAQKQHCHDIVDKTVAQFGR
IDILVNNAAFQMAHESLDDIDDDEWVKTFDTNITAIFRICQRALPSMPKGGSIINTSSVN
SDDPSPSLLAYAATKGAIANFTAGLAQLLGKQGIRVNSVAPGPIWTPLIPATMPDEAVRN
FGSGYPMGRPGQPVEVAPIYVLLGSDEASYISGSRYAVTGGKPIL