Protein Info for PP_2703 in Pseudomonas putida KT2440

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 124 to 154 (31 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 339 to 363 (25 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 27 to 225 (199 residues), 67.8 bits, see alignment E=8.8e-23 PF07690: MFS_1" amino acids 32 to 380 (349 residues), 90.7 bits, see alignment E=9.3e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2703)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JE6 at UniProt or InterPro

Protein Sequence (433 amino acids)

>PP_2703 major facilitator transporter (Pseudomonas putida KT2440)
MIRPLPTSPSLQKGAHSAAQVSSSRKTLVACSLGNALEMYDFTIYSFFAVLIGKHFFPSD
SAMASLLMSLATFGVGFLMRPVGAMVIGRYADRHGRKAALSLTIGLMTLGTAMIAFAPTY
SQIGIFATLLLVTGRLIQGMSAGGEVGTASVFLMESSAVGNRCQSVSWQAASQGYAALVG
AGFGLALSQLLDPSALESWGWRIPFIFGLLIGPVGWYIRTRLPETHEAAPANKAAQGLDA
ELLKRIAQGIGLMASSTIGMYLFVFYMPTYLTTALHYPPGSAMAIACISSGCMAVICPLA
GKFADKYQLRKRLLVWTVAAPVVLTLPVFYLLGQVQHMGLAMMGVAILILPTCIGAGAFF
ALIMEGFPKARRSFGTSVSYSLGVTLFGGFSPLVATWLIAALGTPLAPAYFLLAGGVVSL
ACLRYFPENKGCE