Protein Info for PP_2700 in Pseudomonas putida KT2440

Annotation: AhpC/TSA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF08534: Redoxin" amino acids 3 to 162 (160 residues), 107.6 bits, see alignment E=5.2e-35 PF00578: AhpC-TSA" amino acids 5 to 144 (140 residues), 34 bits, see alignment E=2.6e-12

Best Hits

Swiss-Prot: 50% identical to PRX2B_ARATH: Peroxiredoxin-2B (PRXIIB) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2700)

MetaCyc: 50% identical to glutaredoxin-dependent peroxiredoxin (Arabidopsis thaliana col)
RXN-20687 [EC: 1.11.1.25]

Predicted SEED Role

"Peroxiredoxin"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JE9 at UniProt or InterPro

Protein Sequence (166 amino acids)

>PP_2700 AhpC/TSA family protein (Pseudomonas putida KT2440)
MIKTGDQLPDVTLYQYNNDAGACAIGPKAFSIRERCKHKKVLIFALPGAFTPTCSERHVP
GYVAAAPALFAAGIDEILCVSVNDAFVMNAWGNSLQVGDAVKMIGDGNGEFSEALGLTQD
LSARGLGRRSQRYAMLVDDQVVQYIAVESPGKFEVSDAASLLAVLR