Protein Info for PP_2673 in Pseudomonas putida KT2440

Annotation: Pentapeptide repeat family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13599: Pentapeptide_4" amino acids 40 to 105 (66 residues), 30.3 bits, see alignment E=6.4e-11 amino acids 123 to 191 (69 residues), 31.8 bits, see alignment E=2.1e-11 PF00805: Pentapeptide" amino acids 45 to 83 (39 residues), 39.5 bits, see alignment 4.8e-14 amino acids 75 to 112 (38 residues), 33.1 bits, see alignment 4.9e-12 amino acids 123 to 149 (27 residues), 23.7 bits, see alignment (E = 4.5e-09) amino acids 130 to 168 (39 residues), 36.8 bits, see alignment 3.4e-13 amino acids 170 to 209 (40 residues), 31.6 bits, see alignment 1.5e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2673)

Predicted SEED Role

"pentapeptide repeat family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JH6 at UniProt or InterPro

Protein Sequence (219 amino acids)

>PP_2673 Pentapeptide repeat family protein (Pseudomonas putida KT2440)
MNYLPLTLLLALSPALAVNADDAGTDTPLTINGCVIAEASQCPGANLRGANLANQDLRKM
NLAGADLRDADLRHAQLDLANLEKARLQGANLTRASLQQSNLRLADLSNSRLVAIQGWGL
FAQGAQFEKADLRAAYLQFARLSGAKLQQANLQAADLEMAWLSKADLQEANLGDANLQEA
KFGQSNLAHADLRGARQHYGNFQEANMEGCKGCPETWDK