Protein Info for PP_2657 in Pseudomonas putida KT2440

Annotation: phosphate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 85 to 110 (26 residues), see Phobius details amino acids 122 to 150 (29 residues), see Phobius details amino acids 167 to 169 (3 residues), see Phobius details amino acids 171 to 195 (25 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 252 to 278 (27 residues), see Phobius details amino acids 290 to 316 (27 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 26 to 314 (289 residues), 310.2 bits, see alignment E=5.9e-97 PF00528: BPD_transp_1" amino acids 103 to 317 (215 residues), 50.7 bits, see alignment E=9.2e-18

Best Hits

Swiss-Prot: 38% identical to PSTC_XYLFT: Phosphate transport system permease protein PstC (pstC) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to ppu:PP_2657)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JJ2 at UniProt or InterPro

Protein Sequence (322 amino acids)

>PP_2657 phosphate ABC transporter (Pseudomonas putida KT2440)
MNTPFAIPDNPDSACQPPSAKDFLVDRTFRALARIGVVLVLALVFALVYEVGRKALPGIE
KHGFDVLFGSVWDVNQGKYGILPAIWGTLYSALIALLIAGFFGVSMAIFLTQDFLPAKLA
AVFRTIVELLAAIPSVVYGLWGIYVVIPAIRPLTAWLNSELGWIPFFGTSLSGPGLLPAA
LVLAIMILPTIAAVSQDALTSVPMKTKQAAYGMGTTHWEAILKVMVPSAATGIFGSLVLG
LGRALGETMALAMLVGNANTISLSLFAPANTLAALLALNFPEAGPNEVEVLMYAALVLMF
ITLLVNVLGSMIMLYAQRGNKQ