Protein Info for PP_2657 in Pseudomonas putida KT2440
Annotation: phosphate ABC transporter
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 38% identical to PSTC_XYLFT: Phosphate transport system permease protein PstC (pstC) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)
KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to ppu:PP_2657)Predicted SEED Role
"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88JJ2 at UniProt or InterPro
Protein Sequence (322 amino acids)
>PP_2657 phosphate ABC transporter (Pseudomonas putida KT2440) MNTPFAIPDNPDSACQPPSAKDFLVDRTFRALARIGVVLVLALVFALVYEVGRKALPGIE KHGFDVLFGSVWDVNQGKYGILPAIWGTLYSALIALLIAGFFGVSMAIFLTQDFLPAKLA AVFRTIVELLAAIPSVVYGLWGIYVVIPAIRPLTAWLNSELGWIPFFGTSLSGPGLLPAA LVLAIMILPTIAAVSQDALTSVPMKTKQAAYGMGTTHWEAILKVMVPSAATGIFGSLVLG LGRALGETMALAMLVGNANTISLSLFAPANTLAALLALNFPEAGPNEVEVLMYAALVLMF ITLLVNVLGSMIMLYAQRGNKQ