Protein Info for PP_2643 in Pseudomonas putida KT2440

Annotation: aromatic acid chemoreceptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 198 to 219 (22 residues), see Phobius details PF02203: TarH" amino acids 10 to 159 (150 residues), 39.2 bits, see alignment E=1.1e-13 PF00672: HAMP" amino acids 218 to 268 (51 residues), 44.2 bits, see alignment 2.9e-15 PF00015: MCPsignal" amino acids 337 to 515 (179 residues), 136 bits, see alignment E=1.9e-43

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to ppu:PP_2643)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JK6 at UniProt or InterPro

Protein Sequence (550 amino acids)

>PP_2643 aromatic acid chemoreceptor (Pseudomonas putida KT2440)
MVPTRSTARMLANLKIRTGMFWVLSLFSLTLLFSTASAWWAALGSDQQITELDQTAHQSD
RLNNALLMAIRSSANVSSGFIEQLGGHDESAGKRMALSVELNNKSQALVDEFVENAREPA
LRGLATELQATFAEYAKAVAGQREATRQRSLEQYFKVNSDAGNAMGRLQTLRQQLVTTLS
ERGQQIMLESDRRLARAQLLSLCLLGVTVVLAVLCWAFIAQRVLHPLREAGGHFRRIASG
DLSVPVQGQGNNEIGQLFHELQRMQQSQRDTLGQINNCARQLDAAATALNAVTEESANNL
RQQGQELEQAATAVTEMTTAVEEVARNAITTSQTTSESNQLAAQSRRQVSENIDGTEAMT
REIQTSSAHLQQLVGQVRDIGKVLEVIRSVSEQTNLLALNAAIEAARAGEAGRGFAVVAD
EVRTLAYRTQQSTQEIEQMIGSVQAGTEAAVASMQASTNRAQSTLDVTLASGQVLEGIYS
AIGEINERNLVIASAAEEQAQVAREVDRNLLNIRELSNHSAAGAQQTSEASKALSGLVGE
MTALVGRFKV