Protein Info for PP_2635 in Pseudomonas putida KT2440

Annotation: cellulose synthase and translocator subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 869 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 149 to 165 (17 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 523 to 548 (26 residues), see Phobius details amino acids 553 to 575 (23 residues), see Phobius details amino acids 639 to 658 (20 residues), see Phobius details amino acids 668 to 690 (23 residues), see Phobius details TIGR03030: cellulose synthase catalytic subunit (UDP-forming)" amino acids 149 to 826 (678 residues), 918.4 bits, see alignment E=1.3e-280 PF13641: Glyco_tranf_2_3" amino acids 273 to 500 (228 residues), 71.4 bits, see alignment E=3.7e-23 PF00535: Glycos_transf_2" amino acids 278 to 446 (169 residues), 72.1 bits, see alignment E=1.7e-23 PF13506: Glyco_transf_21" amino acids 339 to 499 (161 residues), 32.6 bits, see alignment E=1.7e-11 PF13632: Glyco_trans_2_3" amino acids 356 to 567 (212 residues), 80.8 bits, see alignment E=3.6e-26 PF03552: Cellulose_synt" amino acids 435 to 573 (139 residues), 49.5 bits, see alignment E=8e-17 PF07238: PilZ" amino acids 694 to 790 (97 residues), 53.2 bits, see alignment E=1e-17

Best Hits

Swiss-Prot: 60% identical to BCSA_SALTY: Cellulose synthase catalytic subunit [UDP-forming] (bcsA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00694, cellulose synthase (UDP-forming) [EC: 2.4.1.12] (inferred from 100% identity to ppu:PP_2635)

MetaCyc: 62% identical to cellulose synthase catalytic subunit (Escherichia coli K-12 substr. MG1655)
Cellulose synthase (UDP-forming). [EC: 2.4.1.12]

Predicted SEED Role

"Cellulose synthase catalytic subunit [UDP-forming] (EC 2.4.1.12)" (EC 2.4.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JL4 at UniProt or InterPro

Protein Sequence (869 amino acids)

>PP_2635 cellulose synthase and translocator subunit (Pseudomonas putida KT2440)
MTLNPLSAYTWFTVRGARLPVAWLFTLGVWLAFLFLRLESPAWQALLAERQRLYPQLAGK
RPTLGDPLRLLIQSLWLLLRRQPQVRTARPGRRALGAVRMHLRAAGGVARHYRGLLIDAL
QQVPARYRASAFKHQASARLRGLSVFARRAFYSVLTVFALSLALLCVTEPFGYLAQLMFI
CLLLVIALLVRHMPGRFPTLMLIVLSTIISCRYLWWRYTSTLNWNDTTDLVFGVILLAAE
TYSWFVLILGYIQTSWPLQRKPANLPANTRHWPTVDLLIPTYNEDLSVVRTTVMAALGLD
WPRECLRIYILDDGRRDAFRAFADEVGVGYIVRPDSKHAKAGNLNHALGVTDSELIAIFD
CDHVPVRSFLQLTVGWFLKDAKLALVQTPHHFFSPDPFERNLGSFRRRPNEGELFYGLIQ
DGNDMWNAAFFCGSCAVLRRTALESIGGFAVETVTEDAHTALRLHRQGWTSAYLSIPQAA
GLATESLSAHIGQRIRWARGMVQIFRTDNPLFGRGLSLFQRVCYANAMLHFLAGLPRLVF
LTAPLAFLLLHAYIIYAPALMILLYVLPHMIHASLTNSRMQGRYRQTFWGEVYETVLAWY
IARPTTVALFAPKKGTFNVTAKGGLMEQEQFDWRIAQPYLWLAALNVVGLGFAVWRLVTG
PTAEIGTVIVSSLWVIYNLLIIGAAVAVAAEVRQVRRAHRVQMRLPAGLMLASGHAYPCT
LVDYSDGGIGLQVQPGLELKPGEQVRLLLNRGQREFAFQACVTRTVGQHVGLVFRDLALQ
QRIDLVHCTFARADAWLGWNEQHEVERPLRSLIDVLKLGGVGYVRLVEHMPPWLRAWLRP
LRSLASWLASYWPRTPQAIPSMNPVDRDA