Protein Info for PP_2632 in Pseudomonas putida KT2440

Annotation: putative endoglucanase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 transmembrane" amino acids 23 to 52 (30 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details TIGR03368: cellulose synthase operon protein YhjU" amino acids 18 to 531 (514 residues), 728.1 bits, see alignment E=2.5e-223 PF11658: CBP_BcsG" amino acids 20 to 525 (506 residues), 732.9 bits, see alignment E=9.4e-225

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2632)

Predicted SEED Role

"FIG002337: predicted inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JL7 at UniProt or InterPro

Protein Sequence (537 amino acids)

>PP_2632 putative endoglucanase (Pseudomonas putida KT2440)
MTNTTITLPVLARWPGLGGWNLYFFAKFLLVALGMLDFQALPNLLFAAFLLVPLPGKWLR
IARQLLAVPIGIALFYQDTWLPPFSRLLAQPGVLDFSWDYLLELLGRFINWNLLGALAML
LVGYLYLRHWLRLSTLSLLGLAWLSVGGLPSLVAGQAPGVAARTAAEPAPATAAADNATL
DSWLERFFASERERVTAFPAVSADEQPFDLLVINICSLAWDDLSAVGLRDNPLLSRMDVI
FDQFNSATSYSGPAAIRVLRASCGQSSHAGLYQPAPEQCLLFQNLARLGFQSNTLLNHSG
RFDNFIGDITQQRMPQPGMRNTDFPRALVGFDGSPIASDLDVLRRWWGQRKGTPDEHVSL
FYNSISLHDGNRIVTADGGTRVADYATRANRLFGELGTFLDELEGSGRRVVVAIVPEHGA
ALHGDRMQLSGMREIPTPSITHVPVGLKFIGMGQPARNEPLRVTAATSYLALSELISRVY
AGLGQQQVLDVPGLLTDLPTTEQVAETSGAQVLNYQGRAYMRLQGQPDWQPIPKERP