Protein Info for PP_2631 in Pseudomonas putida KT2440

Annotation: putative cellulose biosynthesis, BcsF/YhjT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 61 signal peptide" amino acids 6 to 11 (6 residues), see Phobius details amino acids 28 to 31 (4 residues), see Phobius details transmembrane" amino acids 12 to 27 (16 residues), see Phobius details PF11120: CBP_BcsF" amino acids 1 to 56 (56 residues), 93.3 bits, see alignment E=3.4e-31 TIGR03493: celllulose biosynthesis operon protein BcsF/YhjT" amino acids 1 to 61 (61 residues), 93.5 bits, see alignment E=2.8e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2631)

Predicted SEED Role

"FIG005119: putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JL8 at UniProt or InterPro

Protein Sequence (61 amino acids)

>PP_2631 putative cellulose biosynthesis, BcsF/YhjT (Pseudomonas putida KT2440)
MNFVQLLQVVGITALVTLGLALLLVRLCSALRGVLRRRLPPRYLKPLGVRRRAARQEPQN
D