Protein Info for PP_2621 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 transmembrane" amino acids 542 to 559 (18 residues), see Phobius details PF05947: T6SS_TssF" amino acids 3 to 585 (583 residues), 499.2 bits, see alignment E=9.3e-154 TIGR03359: type VI secretion protein, TIGR03359 family" amino acids 5 to 588 (584 residues), 670 bits, see alignment E=2.2e-205

Best Hits

KEGG orthology group: K11896, type VI secretion system protein ImpG (inferred from 100% identity to ppu:PP_2621)

Predicted SEED Role

"Protein ImpG/VasA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JM8 at UniProt or InterPro

Protein Sequence (588 amino acids)

>PP_2621 conserved protein of unknown function (Pseudomonas putida KT2440)
MSLRDRFSEELRYLHELGNDFAKDNPQLARLLGKGASDPDVERLMEAFAFLTAKLRLKLE
DDLPELTHPMLQLLWPNYLRPLPSATIIKFSPVRQSLSQSQRIPKGSRLFSKPVDGVACE
FRTCTAVNIHPFEIDTVAATQTSDSSVICIGLQSLVERPLNSLGCTSLDFYLSGDARTAR
TLYLWVSQYLKHVSVTINGEVRRLPANSIAFPGFSPNDALLPYPQNVFDGYRILQEYFAF
PQRFHFFSVTGLEKIWPAHDSQQVNLEFHFTRQLPDSLRVGKADFNLFCAPAVNLFQHSA
EPIDLSGKDAMVPLKPKGTAPHGYEIFSVDQVISTRTTTDGNTGEHLRTFRPFESFAHEI
EHVQGRTALYYRCQLEECLHGNGVMHRIAFVRADANSYIGELETASIDLTCTNRDLPLAL
GIDDINILTELTPPLATYTNLCTPTRPCRPVLDGQLQWALISNMSLNYLSLLSVEPLKAV
IRAYDFMALHDIQQARTTRKRLEGMRDIHTQPMDWLIKGQPIRGLHTRLKLDQTAFLCEG
DLYLFSCVLAHFFALYASINSFHQLEVINTTNNEHYTWPIQTGKQPLI