Protein Info for PP_2600 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details PF12831: FAD_oxidored" amino acids 11 to 53 (43 residues), 37.7 bits, see alignment 4.1e-13 PF00890: FAD_binding_2" amino acids 11 to 549 (539 residues), 371.4 bits, see alignment E=1.9e-114 PF01266: DAO" amino acids 11 to 60 (50 residues), 35.3 bits, see alignment 2.6e-12 amino acids 209 to 280 (72 residues), 28 bits, see alignment E=4.1e-10 PF13450: NAD_binding_8" amino acids 14 to 48 (35 residues), 23.2 bits, see alignment (E = 1.7e-08)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_3125)

Predicted SEED Role

"3-oxosteroid 1-dehydrogenase (EC 1.3.99.4)" (EC 1.3.99.4)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.99.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JP9 at UniProt or InterPro

Protein Sequence (570 amino acids)

>PP_2600 conserved protein of unknown function (Pseudomonas putida KT2440)
MPSAPLETECDVLVIGSGAAGLAAAVTAAWHGQKVIVAEKEPVFGGATAWSGGWAWVPRN
PLARRAGIEEDIEQPRTYLRHELGANYNAERVDAFLEACPHMVAFFEKYTALQFADGNGI
PDMHGDTPGAALGGHQVIAAPYDAREVGALLPRLRKTMRETSFMGMPIMAGADLAAFLNM
TRSPKALLHVCKRFGRHLYHLARHGRAMHLVNGVALVARLAKSAQDLGVHLQASAPAKRL
LIEGGQVRGAWVATPQGEQLIRAKAVVLAAGGFPNDNARRQQLFPRDASGHDNLALPPKG
CSGDGLRLGESAGGVVATDLKSPVAWAPVSQVPYRDGSVGHFPHIIERGKPGVIGVLANG
KRFVNEAHGYYDYVSAMVAAVPQGQEVCSWLVCDHRFLRRYGLGHARPAPLPVGPHVRNG
YLKRGATLEQLAQACGIDPSGLRATVTDFNTHARNGQDPAFGRGSTPFNRKQGDPQHKGP
NPCVAPIEHGPFYAVKVKPGCFGTFAGLRTDGNARVLDEAGQPIAGLYAAGTDMASVFGG
WYPSGGINLGPALTFGYVAGRHIAGVQGYE