Protein Info for PP_2596 in Pseudomonas putida KT2440

Annotation: putative ABC transporter, permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 transmembrane" amino acids 33 to 58 (26 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 174 to 191 (18 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details PF00664: ABC_membrane" amino acids 70 to 299 (230 residues), 59 bits, see alignment E=6.5e-20 PF00005: ABC_tran" amino acids 366 to 514 (149 residues), 112.9 bits, see alignment E=1.8e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to ppu:PP_2596)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JQ3 at UniProt or InterPro

Protein Sequence (597 amino acids)

>PP_2596 putative ABC transporter, permease/ATP-binding protein (Pseudomonas putida KT2440)
MSDSSTPLDDAAPSTNKARSPLSRVLSPIRGRLALSAVLAAAGSMLALVPLAGIAHIAHL
ALSETATSGAIGRAIAASIASLFTGMTLITAAEMLAHQADNHITHHLRVAIGQRLMQVPL
GWFSERASSEVKRAMQDDIGTLHSLTAHFFTTLGRTVGAVLISVAYLFAMDWRLAVVVLL
PFPAFFLFLHRAIKASAAHMGDVVAGMARIDNAVVEFVNGMPLVKAFGGRGNAQDRYRAA
VDAFANTFTGFTRPLVAAMARANALIAPVTVVGVVLLAGMAFVALGWIEPLQILPFALVA
PGLCAPLQLLHYITHDLNNAVGAAQRVQVLLDTPVLPAPAVGSLPNGSELRVEQLSHAYA
PGNNVLDDVSFTLAPGTTTAIVGPSGAGKSTLARLLLRFFDPDAGRITLGGVDLRQIESR
ELYRRIGFVLQEVRLIHASVADNIALGKPAATREQVEAAARLANIHTRILQLPRGYDSVV
GEDAQLSGGEQQRLSIARAVLLDPPVLVLDEATAAADAESEAAIQDALSRFARGRTLLVI
AHRLDTVMHADQILVLDQGALCEQGRHSELLNRQGLYARLWAQGGYQDTVKKALPAC