Protein Info for PP_2593 in Pseudomonas putida KT2440

Annotation: Ferric siderophore ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 219 to 248 (30 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details PF01032: FecCD" amino acids 27 to 308 (282 residues), 118.6 bits, see alignment E=1.5e-38

Best Hits

Swiss-Prot: 49% identical to FATC_VIBA7: Ferric-anguibactin transport system permease protein FatC (fatC) from Vibrio anguillarum (strain ATCC 68554 / 775)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to ppu:PP_2593)

Predicted SEED Role

"Iron compound ABC uptake transporter permease protein PiuC" in subsystem Heme, hemin uptake and utilization systems in GramPositives

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JQ6 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PP_2593 Ferric siderophore ABC transporter, permease protein (Pseudomonas putida KT2440)
MKGRHCLWLAVVALATLFVFVNAGADFAYLIPKRLVRLAAMVIGGVCVACSAIAFQTLSG
NRILTPAIMGYEAVYLLLQALLVLGMGVQGLILLGSDGNFLLSMLLMLGYSWALHRWLFR
DGKNNVYFLLLVGLVLTMVMATFTQFVQLKVSPGEFSMLLGYTQASFNRASPQLLLYSAV
LVAGVCVLLARAVPVLDVLALGRDQAISLGVDYRRNVRLLLALIAALVAVSTSLLGPTAF
MGVFVANITYAMAGTFRHRVTLALGSAVAIAVFIAAQLLVEHVFNYRTTVGILVNLVCGT
YFLALMVRNRGAA