Protein Info for PP_2577 in Pseudomonas putida KT2440

Annotation: putative paraquat-inducible protein B (pqiB like)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details PF02470: MlaD" amino acids 49 to 137 (89 residues), 40.2 bits, see alignment E=1.6e-14 amino acids 164 to 224 (61 residues), 37.3 bits, see alignment E=1.3e-13 amino acids 293 to 402 (110 residues), 50.9 bits, see alignment E=7.5e-18

Best Hits

KEGG orthology group: K06192, paraquat-inducible protein B (inferred from 100% identity to ppu:PP_2577)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JS2 at UniProt or InterPro

Protein Sequence (546 amino acids)

>PP_2577 putative paraquat-inducible protein B (pqiB like) (Pseudomonas putida KT2440)
MGQQTDKREGPGQVEVRTRRWSVSLVWIVPILAILIGASLVVRNWMQQGPVITISFHSGE
GLVAHKTQVKYRSVVIGEVTTVDLADDKKSVVAKVQLSNDARSFATRGARFWVVRPRIGV
GGVSGVDTLLSGSFIGADSGESKVPEKSFVGLELPPPITYDEKGKRFVLVASDLGSLDIG
SSIYYRKIPVGEVVSFALQDDGKGVEIGVFVQAPYDTFVTADTRFWNASGIDMQIGANGL
KVDTESLSSILVGGLAFGSPDFAAQAEPAADQARFQLFADRDMALSPPHGQAQYLQLRFD
QAMRGLSVGAPVEFKGVEFGRVTSIQLDYDATRQSFPVVVDAVIYPQRLGPVHRKMLAVF
KHTEGDMQGARKLIGTFVEHGLRAQARSGNLITGQMFISLDFYPDAPKVAFDMAADPIMI
PTLPGSLEQLQEQLQRVMERIAKLPLESIAGNLDGSLRELRASLRQFNGQTLPEVKVALD
EVHKTLRTANSAISEDSPQRERMGETLDELERMSRSLRDLADYLGRHPESLIRGRPKAAG
SADLEP