Protein Info for PP_2569 in Pseudomonas putida KT2440

Annotation: Metabolite MFS transporter, MHS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 26 to 51 (26 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 459 to 484 (26 residues), see Phobius details amino acids 504 to 523 (20 residues), see Phobius details amino acids 529 to 547 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 26 to 335 (310 residues), 97.1 bits, see alignment E=1.2e-31 amino acids 461 to 555 (95 residues), 26.3 bits, see alignment E=3.5e-10 PF07690: MFS_1" amino acids 30 to 335 (306 residues), 81.7 bits, see alignment E=4.9e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2569)

Predicted SEED Role

"Major facilitator superfamily transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JS8 at UniProt or InterPro

Protein Sequence (558 amino acids)

>PP_2569 Metabolite MFS transporter, MHS family (Pseudomonas putida KT2440)
MAVLDSTSTGSAPQRGITKEERKVIFASSLGTVFEWYDFYLYGSLAAIIARHFFAGVNET
TSFIFALLAFAAGFAVRPFGAIVFGRLGDMIGRKYTFLITIVIMGLSTAVVGLLPGYATI
GVAAPIILITLRLLQGLALGGEYGGAATYVAEHAPKGRRGFFTAWIQTTATLGLFLSLLV
IMACRTAMGTEAFEAWGWRIPFLLSILLLAISVYIRLQLNESPVFMKMKAEGKASKAPLT
ESFARWDNLKVVIMSLLGGTAGQAVVWYTGQFYALFFLLQTLKIEAQTANLLIAGSLLIG
TPFFIFFGSLSDRIGRKKIIMAGCIIAALTYFPIFKALTEYGNPDVFVAQEQNPVVVVAD
PGQCAFQFDPVGKAKFTSSCDIAKSLLAKRAIPYTNEAAEPGSVAQIRIGERVLPSFDGS
SLAAADFKVQSEAFTATLSGALKEAGYPEKADQAKIHYPMVLLLLTILVIYVTMVYGPIA
AWLVELFPARIRYTSMSLPYHIGNGWFGGFLPTVAFAMVAATGDIYYGLWYPIVIAVMTA
VLGIFFLPETKDRDITHT