Protein Info for PP_2563 in Pseudomonas putida KT2440

Annotation: putative Antibiotic biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 923 transmembrane" amino acids 80 to 102 (23 residues), see Phobius details amino acids 603 to 620 (18 residues), see Phobius details amino acids 626 to 645 (20 residues), see Phobius details amino acids 663 to 686 (24 residues), see Phobius details amino acids 706 to 725 (20 residues), see Phobius details amino acids 737 to 758 (22 residues), see Phobius details amino acids 768 to 785 (18 residues), see Phobius details amino acids 792 to 812 (21 residues), see Phobius details amino acids 818 to 835 (18 residues), see Phobius details amino acids 843 to 860 (18 residues), see Phobius details amino acids 880 to 902 (23 residues), see Phobius details PF00501: AMP-binding" amino acids 26 to 375 (350 residues), 220.4 bits, see alignment E=5.3e-69 TIGR01733: amino acid adenylation domain" amino acids 45 to 450 (406 residues), 365.8 bits, see alignment E=1.3e-113 PF13193: AMP-binding_C" amino acids 434 to 506 (73 residues), 44.6 bits, see alignment E=3.4e-15 PF00550: PP-binding" amino acids 529 to 569 (41 residues), 22.9 bits, see alignment (E = 1.3e-08)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2563)

Predicted SEED Role

"L-aminoadipate-semialdehyde dehydrogenase large subunit (EC 1.2.1.31)" in subsystem Lysine degradation (EC 1.2.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JT4 at UniProt or InterPro

Protein Sequence (923 amino acids)

>PP_2563 putative Antibiotic biosynthesis protein (Pseudomonas putida KT2440)
MPDLRPNPTLCLEYRAEQPIHHAFIQQASRCPAAIAIIGQHATCSYSQLEQISAGIAAFL
VKNAASGTDRVVIVSRRSAALVYAMLGCLRAGLAFTVADAAYPAARIEQIVNTLKPAVIL
RCAEASVDVGQPMVVTVPEALAEALQAFPRQPVALPAVSPEQPAYITFTSGSTGEPKGIV
THHAPLVHFIDWHVRQHGFTQADTFSLLSGLGHDPVYRDVFTPLSLGATIACPAQSTLTE
PSRLASWLHQHGVSVIHLTPPLGKLIETGAHLNGQILDHLRYLFWGGDALSPTQYQQVRA
IAPNAVNVNFYGTTETPQAMAFHTLDPEMDNARVPLGKGIADAQLLVINPANQLVSEGET
GEILIRSPYLSRGYWDDPGLTEAKFIANPFTADTADRCYRTGDLGTYLADGSARFLGRAD
SQVKIRGHRIELAEIENAICRHPHIGQCVVLTNHEGASTRLVAYCVAQQAIRADELRQAL
SGQLPDYMVPALFVFLDALPLTPNAKVDKRALPAAFDDSINPPLSPLAEKLSTAWARILQ
VPRLDARLSFVELGGDSLSFVQASRVLEALIGHLPERWETLPVCQLAELSAPPKGAWRVM
EMPVFIRMLAIILIVVGHLGDFDHWPILGETSVLFLVSGIALARFQLKAIEARGDARTLL
RPLTAIVVPTLLYSALIQLVFARLHWQSLLLVSNWFPASEVSLFNYWYIEVLVQMIVIIG
LVLSIRRVRQVLIADPFRWLIIAACALVALDVLLNQFVFDASALLNRVPQHFLAVMVLGM
AVHHADTISRKWVASAVAVLVVGELDLMALAGVGWQAFTHYVDIALPAMLALVWFRSVPV
PALVARAGAVIASSTLYIYLTHFQFESVAEHVFRHPLFEIALALAGGVLVSYCWNTLLRL
LFTRRRKQHQARGADPAERATSA