Protein Info for PP_2557 in Pseudomonas putida KT2440

Annotation: Sensory box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 TIGR00229: PAS domain S-box protein" amino acids 7 to 124 (118 residues), 61.4 bits, see alignment E=9.1e-21 PF00989: PAS" amino acids 8 to 107 (100 residues), 46 bits, see alignment E=1.5e-15 PF13188: PAS_8" amino acids 11 to 58 (48 residues), 21 bits, see alignment 7.3e-08 PF13426: PAS_9" amino acids 18 to 115 (98 residues), 35.9 bits, see alignment E=2.2e-12 PF08448: PAS_4" amino acids 19 to 118 (100 residues), 29.7 bits, see alignment E=1.9e-10 PF08447: PAS_3" amino acids 29 to 96 (68 residues), 48.7 bits, see alignment E=2.2e-16 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 125 to 282 (158 residues), 135.8 bits, see alignment E=1.1e-43 PF00990: GGDEF" amino acids 128 to 283 (156 residues), 161 bits, see alignment E=6.6e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2557)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JU0 at UniProt or InterPro

Protein Sequence (287 amino acids)

>PP_2557 Sensory box protein (Pseudomonas putida KT2440)
MPVDLQALYPRLIHLMLDTVFVVDRDNQIVFVSDACKTLLGYEACELIGTPITRYMHPDD
LAATRASIMRVMNGQPHYDFCNRYLRKDGSVVHILWAACWSEEAQARIGVARDVTAQRKA
EDELRFLAHHDPLTRLANRAMFNERLDTALAAARRHNRRLALLFLDINDFKQINDNHGHS
VGDRVLCTLARRLERCVGAAGTVARMGGDEFTVLLPDCPSPEAIATHVQHILAVMAEPLD
AEFAGIDAPSCSIGVARFPEDGNDADMLLRHADGHMYRIKRQRAATG