Protein Info for PP_2514 in Pseudomonas putida KT2440

Annotation: 4-carboxy-4-hydroxy-2-oxoadipic acid aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 TIGR02798: 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase" amino acids 9 to 230 (222 residues), 338.3 bits, see alignment E=1e-105 PF03737: RraA-like" amino acids 32 to 179 (148 residues), 146.1 bits, see alignment E=5e-47

Best Hits

Swiss-Prot: 100% identical to GALC_PSEPK: 4-carboxy-4-hydroxy-2-oxoadipic acid aldolase (galC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K10218, 4-hydroxy-4-methyl-2-oxoglutarate aldolase [EC: 4.1.3.17] (inferred from 99% identity to ppf:Pput_3204)

MetaCyc: 100% identical to subunit of 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Pseudomonas putida)
4-hydroxy-4-methyl-2-oxoglutarate aldolase. [EC: 4.1.3.17]; 4.1.3.17 [EC: 4.1.3.17]

Predicted SEED Role

"4-carboxy-4-hydroxy-2-oxoadipate aldolase (EC 4.1.3.17)" (EC 4.1.3.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JX9 at UniProt or InterPro

Protein Sequence (238 amino acids)

>PP_2514 4-carboxy-4-hydroxy-2-oxoadipic acid aldolase (Pseudomonas putida KT2440)
MSGLIGKTGIVVRNIPRVEPHMIDALGRLGVATVHEAQGRKGLLNTAVRPIQQGVAVAGS
AVTVLVAPGDNWMFHVAVEQCRPGDVLVVAPSSPCSDGYFGDLLATSLQARGVLGLVIDA
GVRDSQTLRDMGFAVWSRAINAQGTVKEVLGSVNLPLLCAGQLVNAGDIVVADDDGVVVV
RHGEAQAVLEAATQRADLEERKRLRLAAGELGLDIYEMRPRLAAKGLRYVDHLTDLEG