Protein Info for PP_2507 in Pseudomonas putida KT2440

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 3 to 185 (183 residues), 77.4 bits, E=1.1e-25
• PF13561: adh_short_C2
  • amino acids 7 to 212 (206 residues), 39.8 bits, E=4.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2507)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• D-sorbitol degradation II (1/1 steps found)
• superpathway of hexitol degradation (bacteria) (13/18 steps found)
• L-sorbose degradation (1/2 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

See Q88JY6 at UniProt or InterPro

Protein Sequence (238 amino acids)

>PP_2507 Oxidoreductase, short-chain dehydrogenase/reductase family (Pseudomonas putida KT2440)
MKMMIVGAGRGLGRALLEGLGKPGDTLIGVSRKQPSDLALAPGIDLQWVDADLAKPTAAV
AQIADRAPADLDVLIYNVGIWEEHAFSEHYAFLDDSDESITRLVEVNITATLLLLKRLVP
KLLGAPRPQLILTGSTSALRQSGRPEVAFGASKFALNGMADALREGFRDDNLAVTVLQLG
YLNTDDSLNTPLAQAAASGERRQVPVHDVVTMVDALLRLSGASFVRELILPAIGDERF