Protein Info for PP_2504 in Pseudomonas putida KT2440

Annotation: putative tautomerase K2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 69 TIGR00013: 4-oxalocrotonate tautomerase family enzyme" amino acids 1 to 63 (63 residues), 64.8 bits, see alignment E=3e-22 PF01361: Tautomerase" amino acids 2 to 57 (56 residues), 57.6 bits, see alignment E=4.6e-20

Best Hits

Swiss-Prot: 52% identical to Y2002_DICD3: Probable tautomerase K2 (Dda3937_02002) from Dickeya dadantii (strain 3937)

KEGG orthology group: K01821, 4-oxalocrotonate tautomerase [EC: 5.3.2.-] (inferred from 100% identity to ppu:PP_2504)

Predicted SEED Role

"4-oxalocrotonate tautomerase (EC 5.3.2.-)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 5.3.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JY9 at UniProt or InterPro

Protein Sequence (69 amino acids)

>PP_2504 putative tautomerase K2 (Pseudomonas putida KT2440)
MPFVSVRITRDGVTRDQKAQVIKEITETLQRVLGKKPELTHIVIEEVDTDNWGYAGMTTT
EYRSKETQG