Protein Info for PP_2490 in Pseudomonas putida KT2440

Annotation: Flavoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF00881: Nitroreductase" amino acids 33 to 187 (155 residues), 66.9 bits, see alignment E=2.6e-22 PF28600: Nitroreductase_C" amino acids 197 to 274 (78 residues), 64 bits, see alignment E=1.7e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2490)

Predicted SEED Role

"Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K03 at UniProt or InterPro

Protein Sequence (274 amino acids)

>PP_2490 Flavoprotein (Pseudomonas putida KT2440)
MSLQDEALKAWQARYGEPANLPAADTVIAQMLQHRSVRAYSDLPVDEQMLSWAIAAAQSA
STSSNLQAWSVLAVRDRERLARLARLSGNQRHVEQAPLFLVWLVDWSRLRRLARTLQAPT
AGIDYLESYTVGVVDAALAAQNAALAFEAQGLGIVYIGGMRNHPEAMSEELGLPNDTFAV
FGMCVGHPDPAQPAEIKPRLAQSVVLHRERYEATEAEAVSVAAYDRRMSDFQHRQQRENR
SWSSQAVERVKGADSLSGRHRLRDALNTLGFGLR