Protein Info for PP_2458 in Pseudomonas putida KT2440

Annotation: ribokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF00294: PfkB" amino acids 3 to 295 (293 residues), 231.7 bits, see alignment E=1.3e-72 TIGR02152: ribokinase" amino acids 5 to 300 (296 residues), 363.1 bits, see alignment E=5.9e-113 PF08543: Phos_pyr_kin" amino acids 178 to 279 (102 residues), 39.8 bits, see alignment E=3.5e-14

Best Hits

KEGG orthology group: K00852, ribokinase [EC: 2.7.1.15] (inferred from 100% identity to ppu:PP_2458)

MetaCyc: 42% identical to deoxyribokinase monomer (Salmonella enterica enterica serovar Typhi)
RXN-14223 [EC: 2.7.1.229]

Predicted SEED Role

"Ribokinase (EC 2.7.1.15)" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism (EC 2.7.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.15 or 2.7.1.229

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K34 at UniProt or InterPro

Protein Sequence (302 amino acids)

>PP_2458 ribokinase (Pseudomonas putida KT2440)
MNAKVVVVGSLNMDLVVRAQRLPRAGETLPGDSFFTVPGGKGANQAVAVARLGGSVAMIG
NVGDDDYGRQLHRALYVEGIDCQGVSTCPAMSSGVALITVDAASQNCIVIIPGANGLLTP
QSVRRFDALLQAAEVIICQLEVPASTVAWTLARGHELGKQVILNPAPATGPLPADWFAHI
DYLTPNESEAEALTGVVVTDQDSARRAGERLLQLGAGKVIITLGAQGALLVTAQGHQHYP
APHVQPLDTTAAGDTFIGGFAAGLVRGLEEGEAIAFGQRAAALSVTRAGAQPSIPYLAEL
TP